Neuropeptide Database

Total number of results for Struthio camelus are 10

NPID	Sequence	Length	Organism	Family	Name	Peptide_REF
NP00956	LPVTNNMNKGDTKVMKCIVEVISDTLSKPNPLPISEECLETLRGDERIISILRHQNLLKELQEIAVQGANERTQQQRRTEDQELESLAAIEAELESVAHSLQAL	104	Struthio camelus	Chromogranin/secretogranin	Chromogranin-A	2188233#Lazure C., Paquet L., Litthauer D., Naude R.J., Oelofsen W., Chretien M.#The ostrich pituitary contains a major peptide homologous to mammalian chromogranin A(1-76).# Peptides 11:79-87(1990).
NP02203	QQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS	110	Struthio camelus	Gastrin/cholecystokinin	Cholecystokinin
NP02204	APSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDF	70	Struthio camelus	Gastrin/cholecystokinin	Cholecystokinin-70 (Probable)
NP02205	DYMGWMDF	8	Struthio camelus	Gastrin/cholecystokinin	Cholecystokinin-8	11072120#Jonson L., Schoeman N., Saayman H., Naude R., Jensen H., Johnsen A.H.#Identification of ostrich and chicken cholecystokinin cDNA and intestinal peptides.# Peptides 21:1337-1344(2000).
NP02206	YMGWMDF	7	Struthio camelus	Gastrin/cholecystokinin	Cholecystokinin-7	11072120#Jonson L., Schoeman N., Saayman H., Naude R., Jensen H., Johnsen A.H.#Identification of ostrich and chicken cholecystokinin cDNA and intestinal peptides.# Peptides 21:1337-1344(2000).
NP02420	HSQGTFTSDYSKYLDTRRAQDFVQWLMST	29	Struthio camelus	Glucagon	Glucagon	1938110#Ferreira A., Litthauer D., Saayman H., Oelofsen W., Crabb J., Lazure C.#Purification and primary structure of glucagon from ostrich pancreas splenic lobes.# Int. J. Pept. Protein Res. 38:90-95(1991).
NP02734	AANQHLCGSHLVEALYLVCGERGFFYSPKA	30	Struthio camelus	Insulin	Insulin B chain	3045031#Evans T.K., Litthauer D., Oelofsen W.#Purification and primary structure of ostrich insulin.# Int. J. Pept. Protein Res. 31:454-462(1988).
NP02735	GIVEQCCHNTCSLYQLENYCN	21	Struthio camelus	Insulin	Insulin A chain	3045031#Evans T.K., Litthauer D., Oelofsen W.#Purification and primary structure of ostrich insulin.# Int. J. Pept. Protein Res. 31:454-462(1988).
NP05874	AVLDMDIRKCMPCGPRNKGHCFGPNICCGEELGCYFGTSETLRCQEENFLPTPCESGRKPCGNNEGSCAASGICCSNEGCMVDSSCDQEVMFP	93	Struthio camelus	Vasopressin/oxytocin	Neurophysin 1	3436699#Lazure C., Saayman H.S., Naude R.J., Oelofsen W., Chretien M.#Complete amino acid sequence of a VLDV-type neurophysin from ostrich differs markedly from known mammalian neurophysins.# Int. J. Pept. Protein Res. 30:634-645(1987).
NP05875	ALADAALRQCMPCGPGDRGNCFGPSICCGAELGCYVGTAETLRCAEENYLPSPCRAGGQPCGAGGRCAAPGICCSDETCSLEPACLEEAGERGGEPAQKNLTGLDASAGDFLLKLMHLAANRQQQGGKGPLL	132	Struthio camelus	Vasopressin/oxytocin	Neurophysin 2	2722398#Lazure C., Saayman H.S., Naude R.J., Oelofsen W., Chretien M.#Ostrich MSEL-neurophysin belongs to the class of two-domain 'big' neurophysin as indicated by complete amino acid sequence of the neurophysin/copeptin.# Int. J. Pept. Protein Res. 33:46-58(1989).